PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04013A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 280aa    MW: 30511.7 Da    PI: 5.7181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04013AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.8e-101655148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W++eEde+l++ + ++G g+W++        R++k+c++rw +yl
  Oropetium_20150105_04013A 16 KGLWSPEEDEKLYNHIIRHGVGCWSS--------RCGKSCRLRWINYL 55
                               678**********************9........899*********97 PP

2Myb_DNA-binding52.89e-1761105147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Oropetium_20150105_04013A  61 RGSFSQQEEDLIVALHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 105
                                899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8441155IPR017930Myb domain
SuperFamilySSF466895.24E-2513102IPR009057Homeodomain-like
SMARTSM007175.4E-71557IPR001005SANT/Myb domain
PfamPF002492.1E-91655IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-171762IPR009057Homeodomain-like
CDDcd001671.00E-91955No hitNo description
PROSITE profilePS5129426.03856110IPR017930Myb domain
SMARTSM007172.5E-1660108IPR001005SANT/Myb domain
PfamPF002495.5E-1561105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2663110IPR009057Homeodomain-like
CDDcd001671.47E-1163103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRLSSGGGV QPKLRKGLWS PEEDEKLYNH IIRHGVGCWS SRCGKSCRLR WINYLRPDLK  60
RGSFSQQEED LIVALHEILG NRWSQIASHL PGRTDNEIKN FWNSCLKKKL RQRGIDPSTH  120
KPLAGGGAAA AALPEDRHQD HKPPAAADDD DDGGLAAHHH QKQPVVFDPF PVTDFGGGFD  180
LTGVAAFYGQ YDAVGKAGGF VADYSSVLDV SENLGYGESS SNSSNWNCAD MGNVLDSEVL  240
DWASGGGAKA EPFAEMEQQH GAPCQEQSLA HFDFNLEYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121103108B-MYB
1h8a_C2e-271011021128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105111LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0635971e-110BT063597.1 Zea mays full-length cDNA clone ZM_BFc0084D02 mRNA, complete cds.
GenBankKJ7274941e-110KJ727494.1 Zea mays clone pUT5353 MYB transcription factor (MYB99) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961344.11e-141PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-109MYB3_HORVU; Myb-related protein Hv33
TrEMBLK3Z8601e-141K3Z860_SETIT; Uncharacterized protein
STRINGSi022730m1e-141(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-65myb domain protein 86